Fenomena Nama-Nama Terpanjang Didunia

Bookmark and Share
Lagi-lagi berikut ini ww.com cuplikkan hal-hal unik didunia, yaitu tentang nama-nama terpanjang didunia, nama-nama itu diantaranya nama orang, nama tempat, nama situs maupun nama email address yang panjang dan tercatat sebagai rekor dunia.
Berikut selengkapnya:

1. Nama Kota Terpanjang (58 huruf)

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch merupakan sebuah desa di pulau Anglesey di Wales, Britania Raya.

Desa ini tercatat dalam Guiness Book of Record sebagai tempat dengan nama desa terpanjang di Britania.

2. Nama Domain dan Nama Kota Terpanjang

http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/ merupakan situs untuk mempromosikan sebuah kota di Anglesey, Gwynedd, Inggris. Nama kotanya itu sama seperti nama situsnya.

3. Alamat E-mail Terpanjang

nama yang sangat panjang untuk sebuah email address.
Kamu mau bikin akun disana? buka aja situsnya http://abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com

7. Nama Album Terpanjang (19 kata)

She Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almighty adalah nama sebuah album yang dirilis oleh mantan penyanyi SinĂ©ad O’Connor pada tahun 2003.

8. Nama Orang Terpanjang di Dunia (27 kata)

Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown merupakan nama seorang anak di Inggris. Namanya yang terdiri dari 27 kata diatas diambil dari 25 nama petinju top dari seluruh dunia dan 2 sisanya adalah nama depan dan nama keluarganya.

9. Nama Tempat Terpanjang

Krungthepmahanakonbowornratanakosinmahintarayudyayamahadilopo-noparatanarajthaniburiromudomrajniweshasatarnamornpimarnavatarsatitsakattiyavisa-nukamphrasit. Itu merupakan nama suatu tempat di Thailand. Siapa coba yang mampu menghafalkannya? hehe....

10. Nama Bukit Terpanjang (85 huruf)

Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhe-nuakitanatahu adalah nama sebuah bukit di Porangahau, di selatan Waipukurau di selatan Hawke’s Bay, Selandia Baru.

Nama ini biasanya disingkat jadi Taumata (karena terlalu panjang tentunya ;-)

(Ref: silver-light-of-the-moon.blogspot.com)

{ 1 komentar... Views All / Post Comment! }

bpk muliadi mengatakan...




Posting Komentar